Mouse Anti-Rin Antibody (CBMOAB-29794FYA)


Cat: CBMOAB-29794FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-29794FYA Monoclonal Fruit fly (Drosophila melanogaster), Tomato (Lycopersicon esculentum) WB, ELISA MO29794FYA 100 µg
MO-AB-35138H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO35138C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Tomato (Lycopersicon esculentum)
CloneMO29794FYA
SpecificityThis antibody binds to fruit fly Rin.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Rin Antibody is a mouse antibody against Rin. It can be used for Rin detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT27578p; LD31194p; Rasputin, isoform A; Rasputin, isoform B; Rasputin, isoform C; Rasputin, isoform D; Rasputin, isoform E; rin
UniProt IDQ9VFT4
Protein RefseqThe length of the protein is 690 amino acids long.
The sequence is show below: MVMDATQSQQPSPQSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQDLYIEDEQDGESRSENDEEHDVQVVGGTVDQAVQVAGDVVAQQPQQQQAPPQPQAQVVVPQQVAPVAAGGAAPQQIFYPLPAGAAAGRPVAVLPPAPQAAAVPLPAQFTVPPPQPIQNGVVSHEELQQQQVLVPPSVSPLVQQQQPTGTPVLPIVPVPSAGFQQSPLVAPQLIQQQQQQQPAQLPPQQQQQQQPIQQQQPLQQQQQPLAEPEEVEVAPRQQKPPTPVEDFKTIHEQQQQEKYEAAKQQQNEPKTYANLFKSTSSSPSGFVNAALQQQQQLQQQQQQQQSISSNTYNSSSATSGGGNGSQVSYSTTASSYNNSNGNSRLDNGGPLPQRNNSIRNNKGDFEQRRSSNTQQFGDNQQLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGGNNLNNNMGRLGGNNGPQSRPMGNNNGSGGGMMRNNAGGNNLRQGGGGGNGAPRLGGGGGFGQRQDNRTGGGNNQSNGPLRGAGNGQSGGGNYGRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry