AibGenesis™ Mouse Anti-Spz5 Antibody (CBMOAB-31831FYA)


Cat: CBMOAB-31831FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-31831FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti) WB, ELISA MO31831FYA 100 µg
MO-AB-06026Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO06026Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti)
CloneMO31831FYA
SpecificityThis antibody binds to fruit fly Spz5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNeurotrophin which may function as a ligand for the Toll-related receptors Toll-6 and Toll-7 (PubMed:23892553). Binds to Toll-7 and Toll-6, and probably acts as their ligands in the promotion of motor axon targeting and neuronal survival in the central nervous system (CNS) (PubMed:19018662, PubMed:23892553). Involved in synaptic targeting of ISNb/d motorneurons and also some SNa motorneurons (PubMed:19018662). May be involved in the normal development of specific neurons at the neuromuscular junction (PubMed:24124519). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Spz5 Antibody is a mouse antibody against Spz5. It can be used for Spz5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD26258p; Spatzle 5; spz5
UniProt IDQ9VZX1
Protein RefseqThe length of the protein is 387 amino acids long.
The sequence is show below: MTKSIKRPPPFSCKQVLLTYVILAYTVAAHSSPPPCGLYGAPPCQFLPAPPGQTPTCARPGKTYCEHADNYPTYLIKSLVRKWGYEAATLLVDETWEDFAAVAWHDTPVFYDPKSIFPPRDPAAQDFNGYSYQTPFGGNPQRPSGGGNPLFVSNPSTEAPTYLLYTSSGGGHRSGHRYNSQGGGTSSSGGHLYINQSDKSTPYNATLWLKRLVRDLSRKQRQPDEVQAEVVEPVNEQTEEAEEQDNPAEDHPQSKRDVSLNMDLLDIVGVEAPNPLKKRSRTKRQSPGRSTLCQTTSQFITPQAALNSRGNWMFVVNEQNTARQMVKAELCASNTCSNLCELPNGYNSRCEQKFVQKRLIALQGNGQNLYTDTFWFPSCCVCTIAAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry