Mouse Anti-Tfiia-L Antibody (CBMOAB-32933FYA)


Cat: CBMOAB-32933FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32933FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana) WB, ELISA MO32933FYA 100 µg
CBMOAB-44950FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO44950FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana)
CloneMO32933FYA
SpecificityThis antibody binds to fruit fly Tfiia-L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Tfiia-L Antibody is a mouse antibody against Tfiia-L. It can be used for Tfiia-L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription initiation factor IIA subunit 1; General transcription factor IIA subunit 1; dTFIIA-L; [Cleaved into: Transcription initiation factor IIA alpha chain (TFIIA p30 subunit); Transcription initiation factor IIA beta chain (TFIIA p20 subunit)]; TfIIA-L
UniProt IDP52654
Protein RefseqThe length of the protein is 366 amino acids long.
The sequence is show below: MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDSGDGSHPPPIVANNPKSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQKQQQAASSGQGSIPIVATLDPNRIMPVNITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLAAAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGDAEW.
For Research Use Only | Not For Clinical Use.
Online Inquiry