Mouse Anti-Ugp Antibody (CBMOAB-33849FYA)


Cat: CBMOAB-33849FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-33849FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti), Arabidopsis (Arabidopsis lyrata), Rice, Rice (Oryza) WB, ELISA MO33849FYA 100 µg
CBMOAB-89781FYB Monoclonal Rice (Oryza) WB, ELISA MO89781FYB 100 µg
MO-AB-01018H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO01018C 100 µg
MO-AB-05957Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05957Y 100 µg
MO-MMB-0348 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti), Arabidopsis (Arabidopsis lyrata), Rice, Rice (Oryza)
CloneMO33849FYA
SpecificityThis antibody binds to fruit fly Ugp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Ugp Antibody is a mouse antibody against Ugp. It can be used for Ugp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD13601p; UGP, isoform A; EC 2.7.7.9; UGP
UniProt IDQ9VSW1
Protein RefseqThe length of the protein is 520 amino acids long.
The sequence is show below: MPSGIRPIDVLLERAGVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry