AibGenesis™ Mouse Anti-Vdup1 Antibody (CBMOAB-34103FYA)


Cat: CBMOAB-34103FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34103FYA Monoclonal Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO34103FYA 100 µg
MO-AB-18208Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18208Y 100 µg
MO-AB-31188R Monoclonal Pig (Sus scrofa) WB, ELISA MO31188R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO34103FYA
SpecificityThis antibody binds to fruit fly Vdup1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Vdup1 Antibody is a mouse antibody against Vdup1. It can be used for Vdup1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRE65532p; Vdup1
UniProt IDQ8SYE1
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: MPRKLLKFLIIFDNTSLLYFPGQFLSGRVLIELQDETPALGLHFHVVGEGVVRNGRRQERTYDKENYIDFRMRLLGDVDQGGPAILSPGIHSFPFKLGLPLGLPSTFLGRYGWIQFYCKAALRENNGIIHKNHQVFIVMNPIDLNLEKPILAQPFTCEVEHKLGVVCVSGGQIKCRVSLDRGGYVPGENILVTAFISNYSNVSIKRTKASLTETIEYLARGKVVQTEKRELAVLVRGKIRPGAKDEWHNELYVPPLPPTNLHGCRLIKISYDVFFVIEPKSMEKEIKLQLPIVLATYPFRHSGDAVNANTWPESVLKPDTHTHYPSTLPIFRPWLHEKPIEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry