AibGenesis™ Mouse Anti-Wac Antibody (CBMOAB-34299FYA)


Cat: CBMOAB-34299FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34299FYA Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO34299FYA 100 µg
CBMOAB-62219FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62219FYA 100 µg
MO-AB-06897W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06897W 100 µg
MO-AB-23890H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23890C 100 µg
MO-AB-26198W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26198W 100 µg
MO-AB-47068W Monoclonal Horse (Equus caballus) WB, ELISA MO47068W 100 µg
MO-AB-67767W Monoclonal Marmoset WB, ELISA MO67767W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rhesus (Macaca mulatta)
CloneMO34299FYA
SpecificityThis antibody binds to fruit fly Wac.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a WW domain, which is a protein module found in a wide range of signaling proteins. This domain mediates protein-protein interactions and binds proteins containing short linear peptide motifs that are proline-rich or contain at least one proline. This gene product shares 94% sequence identity with the WAC protein in mouse, however, its exact function is not known. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Wac Antibody is a mouse antibody against Wac. It can be used for Wac detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWee augmin, isoform B; Wee augmin, isoform D; wac
UniProt IDQ9W0S8
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MQNLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSDDDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVELQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALLDRQKTLKIPKDFSIESVIEKVDSLEQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry