Mouse Anti-Wap Antibody (CBMOAB-34309FYA)


Cat: CBMOAB-34309FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34309FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO34309FYA 100 µg
CBMOAB-45977FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO45977FC 100 µg
MO-AB-06999Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06999Y 100 µg
MO-AB-10477Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10477Y 100 µg
MO-AB-30009H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30009C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO34309FYA
SpecificityThis antibody binds to fruit fly Wap.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Wap Antibody is a mouse antibody against Wap. It can be used for Wap detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD15927p; Wings apart, isoform A; Wings apart, isoform B; Wings apart, isoform C; Wings apart, isoform D; wap; CG14614-RA
UniProt IDQ9VR53
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MSSTAGKRKEIYKYLAPWPLYSMNWSVRPDKRFRLALGSFIEEYNNKVQIISLDEDTSEFSAKSTFDHPYPTTKIMWIPDSKGVYPDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTIWGLETGQPHARVYVAGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHTALLRLAWNKQDPNYLATVAMDSCEVIILDVRVPCTPVARLSNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAEGEVNQIQWGATQPDWIAICYNKACEILRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry