AibGenesis™ Mouse Anti-H2BC13 Antibody (MO-AB-31067W)


Cat: MO-AB-31067W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-31067W Monoclonal Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO31067W 100 µg
MO-AB-44994W Monoclonal Horse (Equus caballus) WB, ELISA MO44994W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO31067W
SpecificityThis antibody binds to Dog H2BC13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Extracellular region or secreted; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Dog H2BC13 Antibody is a mouse antibody against H2BC13. It can be used for H2BC13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2B; HIST1H2BG; HIST1H2BC LOC478743
UniProt IDH9GWB1
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry