Mouse Anti-EDDM3A Antibody (MO-AB-25720W)


Cat: MO-AB-25720W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25720W Monoclonal Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO25720W 100 µg
MO-AB-54684W Monoclonal Marmoset WB, ELISA MO54684W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset
CloneMO25720W
SpecificityThis antibody binds to Chimpanzee EDDM3A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTesticular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells.
Product OverviewMouse Anti-Chimpanzee EDDM3A Antibody is a mouse antibody against EDDM3A. It can be used for EDDM3A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease A M1; EDDM3A; RAM1
UniProt IDH2Q7W9
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MTSSLKIWGILSALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGIDGYVDNIEDLRIIEPISN.
For Research Use Only | Not For Clinical Use.
Online Inquiry