AibGenesis™ Mouse Anti-pla2g2e Antibody (MO-AB-06309H)


Cat: MO-AB-06309H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06309H Monoclonal Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO06309C 100 µg
MO-AB-27911H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27911C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO06309C
SpecificityThis antibody binds to Frog pla2g2e.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against pla2g2e. It can be used for pla2g2e detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC85254 protein; pla2g2e; MGC85254
UniProt IDQ66L11
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MKKVLLIGVALALIIVLVTSTPAQFDEMIKVTTIIYGLANFSDYGCHCGLNNQGMPVDDIDWCCHSQDCCYNKAEMSGCNPVTQTYRFYVEEQKKVECMKASNRCEKMICECDEKAANCFRKELEDYNIYFRNFSSLGACRGPRPFC.
For Research Use Only | Not For Clinical Use.
Online Inquiry