Mouse Anti-Archease Antibody (MO-AB-02220W)


Cat: MO-AB-02220W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02220W Monoclonal Fruit fly (Drosophila melanogaster), Drosophila melanogaster WB, ELISA MO02220W 100 µg
MOFY-1222-FY147 Polyclonal Drosophila melanogaster WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Drosophila melanogaster
CloneMO02220W
SpecificityThis antibody binds to Fruit fly Archease.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Fruit fly Archease Antibody is a mouse antibody against Archease. It can be used for Archease detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein archease-like
UniProt IDQ9VD92
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MEVEFSRENFLLPEMKYEYLDHTADVQIHGWGSSLKEAFEQCGVAMFGYMTELDYVSVEQCFEIEAHGDDLESLLFHFLDELLFLFSAEPYLVCKKLEITKFDVENFEISCHCYGEPFELGKHPQGTEVKAITYSAMQIIQDVEASNYEVFVIIDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry