Mouse Anti-Cln7 Antibody (MO-AB-02372W)


Cat: MO-AB-02372W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02372W Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster WB, ELISA MO02372W 100 µg
MOFAB-725W Monoclonal D. melanogaster WB, IHC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster
CloneMO02372W
SpecificityThis antibody binds to Fruit fly Cln7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Fruit fly Cln7 Antibody is a mouse antibody against Cln7. It can be used for Cln7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG8596, isoform A; CG8596, isoform B; CG8596, isoform C; GH22722p; Cln7
UniProt IDQ9VS51
Protein RefseqThe length of the protein is 546 amino acids long.
The sequence is show below: MEFARRVSARFETKRLPEDVDDGLETLEEYKQRWRSVRIIYFTMFLMALGFSIILTGIWPYLNKLDPDAGKEFMGLIVAANPLGQMIFSPIFGWWGNKLGKIRLPLLLSLSLFTLASGIYSSLELRPDNVKYWMLSSRFLIGVSSANIALCRSYLSAATRISERTHAVAMVSLAQVLGFIIGPTLQAAVTPLGDQGHVWLWGKMHFNMYTASGWINVLMSIGNFMMFLPGVFEEHKIAAREVMVMQGGTSEKETWKGIKPSYLSAWTLIVAFFVLVFNFVLLETLGTSLTMDMFAWSNDEALWYMGIMMTTAAIVSLVTFVLIEPMCKIIAERYVLIWGGFSLMFLGRVLFVPWGPDPPKLAQPFNASWNLSESDPIFLGCPTTQKWCGELPALTLTQFIIGFAFTSIGYPIGVTLIQTIFSKVLGPRPQGVWMGWMTGSGCLSRVLGPVFVGSIYTRLGTFWTFGVTSAMMLVSMFWLQCSNRLLIPPTFEKTTPVELKELNKHNGSKLLDDHSPDTHNGSPPEDLSPDQPILGKHGSQHSISHA.
For Research Use Only | Not For Clinical Use.
Online Inquiry