AibGenesis™ Mouse Anti-RNASEK Antibody (MO-AB-03045W)


Cat: MO-AB-03045W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03045W Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO03045W 100 µg
MO-AB-18563W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18563W 100 µg
MO-AB-19338R Monoclonal Cattle (Bos taurus) WB, ELISA MO19338R 100 µg
MO-AB-28541H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28541C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO03045W
SpecificityThis antibody binds to Fruit fly RNASEK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Fruit fly RNASEK Antibody is a mouse antibody against RNASEK. It can be used for RNASEK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease kappa; RNase K; RNase kappa; EC 3.1.-.-; RNASEK
UniProt IDQ8MSF5
Protein RefseqThe length of the protein is 95 amino acids long.
The sequence is show below: MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVTAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry