Mouse Anti-GC2 Antibody (MO-AB-02616W)


Cat: MO-AB-02616W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02616W Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Zebrafish (Danio rerio) WB, ELISA MO02616W 100 µg
CBMOAB-33893FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO33893FC 100 µg
CBMOAB-17293FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO17293FYA 100 µg
CBMOAB-77652FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77652FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Zebrafish (Danio rerio)
CloneMO02616W
SpecificityThis antibody binds to Fruit fly GC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGolgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.
Product OverviewMouse Anti-Fruit fly GC2 Antibody is a mouse antibody against GC2. It can be used for GC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT11783p; GC2
UniProt IDA8WHE0
Protein RefseqThe length of the protein is 240 amino acids long.
The sequence is show below: MYRGSAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEKILGIERTKSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry