AibGenesis™ Mouse Anti-NADP-ME Antibody (MO-AB-48907W)


Cat: MO-AB-48907W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-48907W Monoclonal Maize (Zea mays), Rice WB, ELISA MO48907W 100 µg
MO-MMB-0323 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays), Rice
CloneMO48907W
SpecificityThis antibody binds to Maize NADP-ME.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Maize NADP-ME Antibody is a mouse antibody against NADP-ME. It can be used for NADP-ME detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADP-malic enzyme; NADP-ME
UniProt IDQ5H744
Protein RefseqThe length of the protein is72 amino acids long.
The sequence is show below: MLSTRTAAVAASASPASPWKLGGRSEGGASCDGCRTYRNTLRRRAAPAKVRALPPRRVDAVAMVSNAETETE.
For Research Use Only | Not For Clinical Use.
Online Inquiry