Mouse Anti-cbfa1 Antibody (MO-AB-00178R)


Cat: MO-AB-00178R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00178R Monoclonal Medaka (Oryzias latipes), Chicken (Gallus gallus), Rat (Rattus norvegicus) WB, ELISA MO00178R 100 µg
MO-AB-00999Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00999Y 100 µg
MO-AB-24522H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24522C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes), Chicken (Gallus gallus), Rat (Rattus norvegicus)
CloneMO00178R
SpecificityThis antibody binds to Medaka cbfa1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against cbfa1. It can be used for cbfa1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCore binding factor alpha1 subunit ptotein; cbfa1
UniProt IDQ9DEF2
Protein RefseqThe length of the protein is 461 amino acids long.
The sequence is show below: MASNSLFSTVGPCQQNFFWDPSATRRFSPPSSSLQPVSGKMNDVSPPAGQPDAAAAAPRLRPHENRSMAEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDIPDGTVVTVMAGNDENYSAELRNASGVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLEDPPKTGLFPDRLELERMRVRVAVPTQPPRPSLNTAANSFNPQGQTQITDPRQSQSSPPWSYEQTYPSYLSPMASPSVHSTTPLSSSRGTGLPAISDVPRRLPGSTDLSPFPGQFERQFPSLSLTESRFSSPRMHYPPTFTYTPPVTSAMSLGSAHYHTYLPPPYPGSTQSQSGPFQTSSTPYLYYGASSNSYQFSMVPGGDRSPSRMIPPCTSASTGTSLVNPNLPSQTEGGVDGDGSHSNSPTVLNPGGRIDEAVWRPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry