AibGenesis™ Mouse Anti-ch4 Antibody (MO-AB-00173R)


Cat: MO-AB-00173R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00173R Monoclonal Medaka (Oryzias latipes), Sugar beet (Beta vulgaris) WB, ELISA MO00173R 100 µg
MO-AB-30252H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30252C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes), Sugar beet (Beta vulgaris)
CloneMO00173R
SpecificityThis antibody binds to Medaka ch4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against ch4. It can be used for ch4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCocaine-and amphetamine-regulated transcript ch4; cart; ch4; LOC100533498
UniProt IDE3WET6
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: MVSSRMLLLSASCWLLVALGSCEEQMEERSPEYEAFKTQEEKELIEALQEVLEKLRNKQLPSSEKKLGWLPPCNTSEQCAVRKGARVGKLCGCPRGMECDFSILKCL.
For Research Use Only | Not For Clinical Use.
Online Inquiry