Mouse Anti-cd1 Antibody (MO-AB-24420R)


Cat: MO-AB-24420R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24420R Monoclonal Pig (Sus scrofa), Porcine WB, ELISA MO24420R 100 µg
MOFY-0522-FY58 Monoclonal Porcine FC, IHC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Porcine
CloneMO24420R
SpecificityThis antibody binds to Pig cd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against cd1. It can be used for cd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD1 protein, Fragment; cd1
UniProt IDO97929
Protein RefseqThe length of the protein is 65 amino acids long.
The sequence is show below: VCHVSGLYPKPVWVMWMRGEQEQPGTQQGDILPHADGTWYLRVTLDVAAGEASGLSCRVKHSSLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry