Mouse Anti-Bcl2l13 Antibody (MO-AB-24347H)


Cat: MO-AB-24347H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24347H Monoclonal Rat (Rattus norvegicus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO24347C 100 µg
CBMOAB-36866FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36866FYA 100 µg
CBMOAB-67573FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67573FYA 100 µg
MO-AB-08099W Monoclonal Cat (Felis catus) WB, ELISA MO08099W 100 µg
MO-AB-13850W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13850W 100 µg
MO-AB-08026R Monoclonal Cattle (Bos taurus) WB, ELISA MO08026R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO24347C
SpecificityThis antibody binds to Rat Bcl2l13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrially-localized protein with conserved B-cell lymphoma 2 homology motifs. Overexpression of the encoded protein results in apoptosis. Alternatively spliced transcript variants have been observed for this gene.
Product OverviewThis product is a mouse antibody against Bcl2l13. It can be used for Bcl2l13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCL2-like 13; Apoptosis facilitator; Protein Bcl2l13; Bcl2l13
UniProt IDD3ZT71
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MASSSSSTTVPLGFHYETKYVVLSYLGLLSQEKQQGPSPQGSQLDVAPQSLNPEVLLKIKSEIEEELKSLDKEVSEAFTSTGFDCHTSPVFSPANPESSVEDCLAQLGERVSRDLSEPLQKALQMILSQPVTYEAYRECTVETAVHANFGASSFATTNAFGIGTAWSRAFEYAATVWCDVSGGARSRVHHSARWLGHRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry