AibGenesis™ Mouse Anti-Mymx Antibody (MO-AB-27353H)
Cat: MO-AB-27353H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus), Zebrafish |
| Clone | MO27353C |
| Specificity | This antibody binds to Rat Mymx. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Plasma membrane; Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | MYMX (Myomixer, myoblast fusion factor) is a protein-coding gene. |
| Product Overview | This product is a mouse antibody against Mymx. It can be used for Mymx detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein Gm7325; Gm7325 |
| UniProt ID | D4A557 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: GPGPAMPVPLLPLMLRSLLSRLLLPVARLARQHLLPLLRRLARRLSSQDVREALLSCLLFVLSQQQPPDSGETSRVDHSQRKERLGPRK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry