Mouse Anti-Rhesus ABO Antibody (CBMOAB-34895FYA)


Cat: CBMOAB-34895FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34895FYA
SpecificityThis antibody binds to Rhesus ABO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.
Product OverviewMouse Anti-Rhesus ABO Antibody is a mouse antibody against ABO. It can be used for ABO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABO
UniProt IDF6WUM3
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: GKPKCYTFLPMILFLMMLVLVLFGYGVLSPRSLMPGSLERGFCTAFREPDGLQRVSLTRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVALGTGRQLSVLGVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCADVDMEFRDHVGVEILTPLFGTLHPAFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANSIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFVAVPKNHQAVRNP.
For Research Use Only | Not For Clinical Use.
Online Inquiry