AibGenesis™ Mouse Anti-ABO Antibody (CBMOAB-34895FYA)


Cat: CBMOAB-34895FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34895FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO34895FYA 100 µg
CBMOAB-00508FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO00508FYA 100 µg
CBMOAB-64526FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64526FYA 100 µg
MO-AB-27169W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27169W 100 µg
MO-AB-28788W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28788W 100 µg
MO-AB-06816R Monoclonal Cattle (Bos taurus) WB, ELISA MO06816R 100 µg
MO-AB-23461R Monoclonal Pig (Sus scrofa) WB, ELISA MO23461R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO34895FYA
SpecificityThis antibody binds to Rhesus ABO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ABO Antibody is a mouse antibody against ABO. It can be used for ABO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABO
UniProt IDF6WUM3
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: GKPKCYTFLPMILFLMMLVLVLFGYGVLSPRSLMPGSLERGFCTAFREPDGLQRVSLTRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVALGTGRQLSVLGVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCADVDMEFRDHVGVEILTPLFGTLHPAFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANSIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFVAVPKNHQAVRNP.
See other products for " ABO "
For Research Use Only | Not For Clinical Use.
Online Inquiry