Mouse Anti-ABO Antibody (CBMOAB-34895FYA)
Cat: CBMOAB-34895FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-34895FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO34895FYA | 100 µg | ||
| CBMOAB-00508FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00508FYA | 100 µg | ||
| CBMOAB-64526FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64526FYA | 100 µg | ||
| MO-AB-27169W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO27169W | 100 µg | ||
| MO-AB-28788W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28788W | 100 µg | ||
| MO-AB-06816R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06816R | 100 µg | ||
| MO-AB-23461R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23461R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO34895FYA |
| Specificity | This antibody binds to Rhesus ABO. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ABO Antibody is a mouse antibody against ABO. It can be used for ABO detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ABO |
| UniProt ID | F6WUM3 |
| Protein Refseq | The length of the protein is 345 amino acids long. The sequence is show below: GKPKCYTFLPMILFLMMLVLVLFGYGVLSPRSLMPGSLERGFCTAFREPDGLQRVSLTRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVALGTGRQLSVLGVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCADVDMEFRDHVGVEILTPLFGTLHPAFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANSIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFVAVPKNHQAVRNP. |
See other products for " ABO "
| MO-AB-50266W | Mouse Anti-ABO Antibody (MO-AB-50266W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry