Mouse Anti-Rhesus ACKR4 Antibody (CBMOAB-34957FYA)


Cat: CBMOAB-34957FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34957FYA
SpecificityThis antibody binds to Rhesus ACKR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. A pseudogene of this gene is found on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been described.
Product OverviewMouse Anti-Rhesus ACKR4 Antibody is a mouse antibody against ACKR4. It can be used for ACKR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACKR4
UniProt IDF7A3Q4
Protein RefseqThe length of the protein is 350 amino acids long.
The sequence is show below: MALEQNQSTDYYYEENETNGSYDYSQYELICIKEDVREFAKVFLPVFLTIAFVIGLAGNSTVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGEIMCKITSALYTLNFVSGMQFLACISIDRYVAVTKGPSQSAVGKPCWVICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPHYLGTSMKASIQMLEICIGFVVPFLIMGVCYFITARTLMKMPNIKISRPLKVLLTVVLVFIVTQLPYNIVKFCRAIDIIYSLITNCNMSKRMDIAIQITESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQSVEEFRFDSEGPTEPTSTFSI.
For Research Use Only | Not For Clinical Use.
Online Inquiry