Mouse Anti-Rhesus ACLY Antibody (CBMOAB-34958FYA)


Cat: CBMOAB-34958FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34958FYA
SpecificityThis antibody binds to Rhesus ACLY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Rhesus ACLY Antibody is a mouse antibody against ACLY. It can be used for ACLY detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACLY
UniProt IDF6YSF2
Protein RefseqThe length of the protein is 591 amino acids long.
The sequence is show below: MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTVFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQV.
See other products for " ACLY "
MO-AB-00912WMouse Anti-Rhesus ACLY Antibody (MO-AB-00912W)
CBMOAB-61502FYCMouse Anti-A. thaliana ACLY Antibody (CBMOAB-61502FYC)
MO-AB-14065YMouse Anti-Sheep ACLY Antibody (MO-AB-14065Y)
MO-AB-23477RMouse Anti-Pig ACLY Antibody (MO-AB-23477R)
MO-AB-06891RMouse Anti-Cattle ACLY Antibody (MO-AB-06891R)
MO-AB-01174HMouse Anti-Frog acly Antibody (MO-AB-01174H)
MO-AB-17412WMouse Anti-Chimpanzee ACLY Antibody (MO-AB-17412W)
MO-AB-50321WMouse Anti-Marmoset ACLY Antibody (MO-AB-50321W)
For Research Use Only | Not For Clinical Use.
Online Inquiry