Mouse Anti-ACLY Antibody (CBMOAB-34958FYA)


Cat: CBMOAB-34958FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34958FYA Monoclonal Rhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO34958FYA 100 µg
CBMOAB-61502FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO61502FYC 100 µg
MO-AB-00912W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO00912W 100 µg
MO-AB-17412W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17412W 100 µg
MO-AB-50321W Monoclonal Marmoset WB, ELISA MO50321W 100 µg
MO-AB-06891R Monoclonal Cattle (Bos taurus) WB, ELISA MO06891R 100 µg
MO-AB-23477R Monoclonal Pig (Sus scrofa) WB, ELISA MO23477R 100 µg
MO-AB-01174H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01174C 100 µg
MO-AB-14065Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14065Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO34958FYA
SpecificityThis antibody binds to Rhesus ACLY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Rhesus ACLY Antibody is a mouse antibody against ACLY. It can be used for ACLY detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACLY
UniProt IDF6YSF2
Protein RefseqThe length of the protein is 591 amino acids long.
The sequence is show below: MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTVFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry