Mouse Anti-Rhesus ACOT8 Antibody (CBMOAB-34972FYA)


Cat: CBMOAB-34972FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34972FYA
SpecificityThis antibody binds to Rhesus ACOT8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells.
Product OverviewMouse Anti-Rhesus ACOT8 Antibody is a mouse antibody against ACOT8. It can be used for ACOT8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACOT8
UniProt IDF7G1F8
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: MSSPQAPEDGQGCGDRGDPPRDLRSVLVTTVLNLEPLDEDLFRGPKRASTVPSGADTNRVELLGALCEGRATWEAHLHLPGLLPAGPAQPHAAPVLHAHCATTRRAA.
See other products for " ACOT8 "
MO-AB-06900RMouse Anti-Cattle ACOT8 Antibody (MO-AB-06900R)
MO-AB-50330WMouse Anti-Marmoset ACOT8 Antibody (MO-AB-50330W)
CBMOAB-64679FYAMouse Anti-Zebrafish acot8 Antibody (CBMOAB-64679FYA)
MO-AB-24723WMouse Anti-Chimpanzee ACOT8 Antibody (MO-AB-24723W)
For Research Use Only | Not For Clinical Use.
Online Inquiry