Mouse Anti-ACOT8 Antibody (CBMOAB-34972FYA)


Cat: CBMOAB-34972FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34972FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO34972FYA 100 µg
CBMOAB-64679FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64679FYA 100 µg
MO-AB-06900R Monoclonal Cattle (Bos taurus) WB, ELISA MO06900R 100 µg
MO-AB-24723W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24723W 100 µg
MO-AB-50330W Monoclonal Marmoset WB, ELISA MO50330W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO34972FYA
SpecificityThis antibody binds to Rhesus ACOT8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. (From NCBI)
Product OverviewMouse Anti-Rhesus ACOT8 Antibody is a mouse antibody against ACOT8. It can be used for ACOT8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACOT8
UniProt IDF7G1F8
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: MSSPQAPEDGQGCGDRGDPPRDLRSVLVTTVLNLEPLDEDLFRGPKRASTVPSGADTNRVELLGALCEGRATWEAHLHLPGLLPAGPAQPHAAPVLHAHCATTRRAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry