Mouse Anti-ALG10 Antibody (CBMOAB-35509FYA)


Cat: CBMOAB-35509FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35509FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35509FYA 100 µg
CBMOAB-65530FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65530FYA 100 µg
MO-AB-07243R Monoclonal Cattle (Bos taurus) WB, ELISA MO07243R 100 µg
MO-AB-13199W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13199W 100 µg
MO-AB-50727W Monoclonal Marmoset WB, ELISA MO50727W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO35509FYA
SpecificityThis antibody binds to Rhesus ALG10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go (EAG) potassium ion channel. (From NCBI)
Product OverviewMouse Anti-Rhesus ALG10 Antibody is a mouse antibody against ALG10. It can be used for ALG10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase; ALG10
UniProt IDH9FF76
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: ITTLPGLYLVSVGVVKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFRKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFVTFRKILQFLLAYSMSFKNLSVLFRLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLFFSFPHLLSPGKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWKRVFQRYEIVKYLLVPAYIFAGWSIADSLKSKSVFWNLMFFICLFIVIVPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry