AibGenesis™ Mouse Anti-AMOTL2 Antibody (CBMOAB-35613FYA)


Cat: CBMOAB-35613FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35613FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO35613FYA 100 µg
MO-AB-07310R Monoclonal Cattle (Bos taurus) WB, ELISA MO07310R 100 µg
MO-AB-23004W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23004W 100 µg
MO-AB-50794W Monoclonal Marmoset WB, ELISA MO50794W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO35613FYA
SpecificityThis antibody binds to Rhesus AMOTL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AMOTL2 Antibody is a mouse antibody against AMOTL2. It can be used for AMOTL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAMOTL2
UniProt IDF7GHP0
Protein RefseqThe length of the protein is 70 amino acids long.
The sequence is show below: RIPHFSPRSYCVCLAPPLAMSSQKTFKIKQFLAKKQKQNRPIPQWIRMKTGNKIRYSSKRRHWRRTKLGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry