Mouse Anti-ANKRD45 Antibody (CBMOAB-35766FYA)


Cat: CBMOAB-35766FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35766FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35766FYA 100 µg
CBMOAB-65850FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65850FYA 100 µg
MO-AB-01429H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01429C 100 µg
MO-AB-24072H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24072C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35766FYA
SpecificityThis antibody binds to Rhesus ANKRD45.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ANKRD45 Antibody is a mouse antibody against ANKRD45. It can be used for ANKRD45 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesANKRD45
UniProt IDF7AXA9
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: VFLELMESEGPPESESSEFFSQQEEEDEEEEVQEPEETGPRNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELLEQRQQLEDTVTPIFAKMTTPRQVKSAKSITSHDQKRSQDDTSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry