Mouse Anti-ANKRD49 Antibody (CBMOAB-35770FYA)


Cat: CBMOAB-35770FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35770FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35770FYA 100 µg
CBMOAB-65855FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65855FYA 100 µg
MO-AB-07370R Monoclonal Cattle (Bos taurus) WB, ELISA MO07370R 100 µg
MO-AB-16155W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16155W 100 µg
MO-AB-24074H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24074C 100 µg
MO-AB-50895W Monoclonal Marmoset WB, ELISA MO50895W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35770FYA
SpecificityThis antibody binds to Rhesus ANKRD49.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInduces HBG1 expression (PubMed:16131492, PubMed:11162141). May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus ANKRD49 Antibody is a mouse antibody against ANKRD49. It can be used for ANKRD49 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnkyrin repeat domain-containing protein 49; ANKRD49
UniProt IDH9EQU3
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYQLQEKKMEKDPSKLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVRELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETACDIARRTSIYHYLFEIVEGCTNSSPQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry