Mouse Anti-Rhesus ANXA9 Antibody (CBMOAB-35907FYA)


Cat: CBMOAB-35907FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35907FYA
SpecificityThis antibody binds to Rhesus ANXA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol; Other locations; Plasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact.
Product OverviewMouse Anti-Rhesus ANXA9 Antibody is a mouse antibody against ANXA9. It can be used for ANXA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnnexin; ANXA9
UniProt IDF7E6S3
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MSASGGKMGPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRAFQERTQQDLLKSLRAALSGNLERIVMALLQPAARFDAQELRTALKASDSAVDVAIEILATRTPPRLQECLAVYKHDFQVEAVDDITSQTNGILRDLLLALVKGGRDSYSGIIDYNLAEQDVRALQRAEGPSTEETWVPLLTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQAALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM.
See other products for " ANXA9 "
MO-AB-34390WMouse Anti-Ferret ANXA9 Antibody (MO-AB-34390W)
MO-AB-14208YMouse Anti-Sheep ANXA9 Antibody (MO-AB-14208Y)
MO-AB-41244WMouse Anti-Guinea pig ANXA9 Antibody (MO-AB-41244W)
MO-AB-50971WMouse Anti-Marmoset ANXA9 Antibody (MO-AB-50971W)
MO-AB-28971WMouse Anti-Dog ANXA9 Antibody (MO-AB-28971W)
MO-AB-23763RMouse Anti-Pig ANXA9 Antibody (MO-AB-23763R)
MO-AB-07419RMouse Anti-Cattle ANXA9 Antibody (MO-AB-07419R)
MO-AB-43685WMouse Anti-Horse ANXA9 Antibody (MO-AB-43685W)
MO-AB-01453HMouse Anti-Frog anxa9 Antibody (MO-AB-01453H)
MO-AB-00085LMouse Anti-Elephant ANXA9 Antibody (MO-AB-00085L)
For Research Use Only | Not For Clinical Use.
Online Inquiry