AibGenesis™ Mouse Anti-AP1S1 Antibody (CBMOAB-35924FYA)


Cat: CBMOAB-35924FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35924FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35924FYA 100 µg
CBMOAB-66028FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66028FYA 100 µg
MO-AB-01463H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01463C 100 µg
MO-AB-07435R Monoclonal Cattle (Bos taurus) WB, ELISA MO07435R 100 µg
MO-AB-20633W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20633W 100 µg
MO-AB-24084H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24084C 100 µg
MO-AB-34394W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34394W 100 µg
MO-AB-36696W Monoclonal Goat (Capra hircus) WB, ELISA MO36696W 100 µg
MO-AB-50994W Monoclonal Marmoset WB, ELISA MO50994W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35924FYA
SpecificityThis antibody binds to Rhesus AP1S1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. (From NCBI)
Product OverviewMouse Anti-Rhesus AP1S1 Antibody is a mouse antibody against AP1S1. It can be used for AP1S1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP1S1
UniProt IDF6QP03
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEGDESPESAVMSEPGLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry