Mouse Anti-AP3M2 Antibody (CBMOAB-35942FYA)


Cat: CBMOAB-35942FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35942FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset WB, ELISA MO35942FYA 100 µg
CBMOAB-66062FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66062FYA 100 µg
MO-AB-01469H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01469C 100 µg
MO-AB-18798W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18798W 100 µg
MO-AB-51030W Monoclonal Marmoset WB, ELISA MO51030W 100 µg
MO-DKB-03421W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus), Zebrafish (Danio rerio) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset
CloneMO35942FYA
SpecificityThis antibody binds to Rhesus AP3M2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles. Multiple alternatively spliced variants, encoding the same protein, have been identified. (From NCBI)
Product OverviewMouse Anti-Rhesus AP3M2 Antibody is a mouse antibody against AP3M2. It can be used for AP3M2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP3M2
UniProt IDF7BHX4
Protein RefseqThe length of the protein is 417 amino acids long.
The sequence is show below: MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVSLLRRTEKVSVICSFCLIPVSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKPPNLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry