AibGenesis™ Mouse Anti-APOLD1 Antibody (CBMOAB-36072FYA)


Cat: CBMOAB-36072FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36072FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO36072FYA 100 µg
MO-AB-01095W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01095W 100 µg
MO-AB-07508R Monoclonal Cattle (Bos taurus) WB, ELISA MO07508R 100 µg
MO-AB-24123H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24123C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO36072FYA
SpecificityThis antibody binds to Rhesus APOLD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus APOLD1 Antibody is a mouse antibody against APOLD1. It can be used for APOLD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOLD1
UniProt IDH9H361
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: GMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGASLLASAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKVQKLAESLESCTGALDELSEQLESRVQLCTKYSRGHDLKISADQRAGLFF.
For Research Use Only | Not For Clinical Use.
Online Inquiry