AibGenesis™ Mouse Anti-APOOL Antibody (CBMOAB-36080FYA)


Cat: CBMOAB-36080FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36080FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO36080FYA 100 µg
MO-AB-00155Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00155Y 100 µg
MO-AB-01499H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01499C 100 µg
MO-AB-22366W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22366W 100 µg
MO-AB-24128H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24128C 100 µg
MO-AB-51112W Monoclonal Marmoset WB, ELISA MO51112W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO36080FYA
SpecificityThis antibody binds to Rhesus APOOL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which contains an apolipoprotein O superfamily domain. This domain is found on proteins in circulating lipoprotein complexes. (From NCBI)
Product OverviewMouse Anti-Rhesus APOOL Antibody is a mouse antibody against APOOL. It can be used for APOOL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein O-like; APOOL
UniProt IDI0FI53
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: MAAIRMGKLTTMPAGLIYASVSVHAVKEEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRTATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMAVITVSGLAGLVSARKGSRFKKITYPLGLATLGATVCYPVQSIIIAKVTGKKIYATSQQIFGAVKSLWTKSSKEESLPKHKEKTKLGSSVEIEVPAKTTDVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry