AibGenesis™ Mouse Anti-APOPT1 Antibody (CBMOAB-36083FYA)


Cat: CBMOAB-36083FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36083FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36083FYA 100 µg
CBMOAB-66189FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66189FYA 100 µg
MO-AB-51113W Monoclonal Marmoset WB, ELISA MO51113W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO36083FYA
SpecificityThis antibody binds to Rhesus APOPT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that localizes to the mitochondria, where it stimulates the release of cytochrome c, thereby promoting programmed cell death. Mutations in this gene have been found in individuals with mitochondrial complex IV deficiency. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus APOPT1 Antibody is a mouse antibody against APOPT1. It can be used for APOPT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 14 open reading frame 153; APOPT1
UniProt IDI2CXR5
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MLPCAAGARGRGAMVALRAGKKSFLRALSRSFVCRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPSEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKSNN.
For Research Use Only | Not For Clinical Use.
Online Inquiry