Mouse Anti-ARL11 Antibody (CBMOAB-36259FYA)


Cat: CBMOAB-36259FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36259FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36259FYA 100 µg
CBMOAB-66494FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66494FYA 100 µg
MO-AB-07585R Monoclonal Cattle (Bos taurus) WB, ELISA MO07585R 100 µg
MO-AB-18422W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18422W 100 µg
MO-AB-24151H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24151C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36259FYA
SpecificityThis antibody binds to Rhesus ARL11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. (From NCBI)
Product OverviewMouse Anti-Rhesus ARL11 Antibody is a mouse antibody against ARL11. It can be used for ARL11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARL11
UniProt IDF7HSH3
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MGSVNSRGHKAKAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLEAPGHVSLTLWDVGGQAPLRASWKDYLEGTDTLVYVLDSTDEARLPESAAELTEVLSDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDRCWELRGCSALTGEGLPEALQSLRSLLKSRRCLCLQERAGGAEHGDSKRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry