Mouse Anti-Rhesus ARSE Antibody (CBMOAB-36319FYA)


Cat: CBMOAB-36319FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36319FYA
SpecificityThis antibody binds to Rhesus ARSE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionArylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the Y chromosome.
Product OverviewMouse Anti-Rhesus ARSE Antibody is a mouse antibody against ARSE. It can be used for ARSE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArylsulfatase E; ARSE
UniProt IDH9F3M8
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: LLLAGSYFVGALIVHADCLLMRNHTITEQPMRFQKTTPLILREVASFLKRNKHGPFLLFVSFLHVHIPLITMETFLGKSLHGLYGDNVEEMDWMVGQILDTLDMEGLTNSTLIYFTSDHGGSLENQLGRTQYGGWNGIYKGGKGMGGWEGGIRVPGIFRWPGVLPAGQVIGEPTSLMDVFPTVDQLAGGEVPQDRVIDGQDLLPLLLGTAQHSDHEFLMHYCEGFLHAARWHQRDKGTTWKVHFVTPVFQPEGAGACYGRKVCPCFGEKVLHHDPPLLFDLSRDPSETHVLTPASEPVFYQVMERVQRAVREHQRTLSPVPLQLDRLGNIWRPWLQPCCGPFPLCWCLREDGPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry