AibGenesis™ Mouse Anti-AS3MT Antibody (CBMOAB-36333FYA)


Cat: CBMOAB-36333FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36333FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36333FYA 100 µg
CBMOAB-66652FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66652FYA 100 µg
MO-AB-07665R Monoclonal Cattle (Bos taurus) WB, ELISA MO07665R 100 µg
MO-AB-24193H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24193C 100 µg
MO-AB-36711W Monoclonal Goat (Capra hircus) WB, ELISA MO36711W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36333FYA
SpecificityThis antibody binds to Rhesus AS3MT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AS3MT Antibody is a mouse antibody against AS3MT. It can be used for AS3MT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAS3MT
UniProt IDF7DBC7
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: VAAPHDAEIRKDVQTYYGQVLKKSADLQTNACVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGGGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESYDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAILAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKCSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPISGGCSALPFDRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry