AibGenesis™ Mouse Anti-ASB13 Antibody (CBMOAB-36356FYA)


Cat: CBMOAB-36356FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36356FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO36356FYA 100 µg
MO-AB-01639H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01639C 100 µg
MO-AB-16560W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16560W 100 µg
MO-AB-51373W Monoclonal Marmoset WB, ELISA MO51373W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO36356FYA
SpecificityThis antibody binds to Rhesus ASB13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants, both protein-coding and not protein-coding, have been described for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ASB13 Antibody is a mouse antibody against ASB13. It can be used for ASB13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnkyrin repeat and SOCS box protein 13; ASB13
UniProt IDI2CW69
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCLEYYEKTPLTLSQLCRVSLRKATGVRGLEKIAKLNIPPRLIDYLSYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry