AibGenesis™ Mouse Anti-ASB14 Antibody (CBMOAB-36357FYA)


Cat: CBMOAB-36357FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36357FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO36357FYA 100 µg
MO-AB-03398W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03398W 100 µg
MO-AB-07671R Monoclonal Cattle (Bos taurus) WB, ELISA MO07671R 100 µg
MO-AB-10670Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10670Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), O. mykiss (Oncorhynchus mykiss)
CloneMO36357FYA
SpecificityThis antibody binds to Rhesus ASB14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus ASB14 Antibody is a mouse antibody against ASB14. It can be used for ASB14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASB14
UniProt IDF7HIF1
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MLKCILKFFLRALKILIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRVSKHYDDHRKSALHFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDEVMLRMLLNYGYDTQRCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCEVITLSWLQHLSGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRLKIRKCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGQGIFTGTW.
For Research Use Only | Not For Clinical Use.
Online Inquiry