AibGenesis™ Mouse Anti-ASB6 Antibody (CBMOAB-36370FYA)


Cat: CBMOAB-36370FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36370FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO36370FYA 100 µg
CBMOAB-66731FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66731FYA 100 µg
MO-AB-01643H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01643C 100 µg
MO-AB-07680R Monoclonal Cattle (Bos taurus) WB, ELISA MO07680R 100 µg
MO-AB-21398W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21398W 100 µg
MO-AB-23885R Monoclonal Pig (Sus scrofa) WB, ELISA MO23885R 100 µg
MO-AB-51380W Monoclonal Marmoset WB, ELISA MO51380W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO36370FYA
SpecificityThis antibody binds to Rhesus ASB6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. Alternatively spliced transcript variants have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ASB6 Antibody is a mouse antibody against ASB6. It can be used for ASB6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASB6
UniProt IDF7H7C2
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEENRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTQAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADINRRDRERLLCSMLWPAAMGYRSTILRTSGSCWKEGQTSRPPPRMGTQCSPASSSYLVRLWEGTKRRPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry