AibGenesis™ Mouse Anti-ATP5F1 Antibody (CBMOAB-36568FYA)


Cat: CBMOAB-36568FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36568FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO36568FYA 100 µg
CBMOAB-67095FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67095FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO36568FYA
SpecificityThis antibody binds to Rhesus ATP5F1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP5F1 Antibody is a mouse antibody against ATP5F1. It can be used for ATP5F1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase subunit b, mitochondrial; ATP5F1
UniProt IDI2CY28
Protein RefseqThe length of the protein is 256 amino acids long.
The sequence is show below: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLAPIPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVITAETFTAMSLIGIMVYGIKKYGPTVAAYADKINEQKLAQLEEAKQSSIQQMQNAIDTEKSQQALTQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKSRLDYHIAVQNMTRRKEQEHMINWVEKHVVQSISTEQEKETVAKCIADLKLLAKKAQAPLVM.
For Research Use Only | Not For Clinical Use.
Online Inquiry