AibGenesis™ Mouse Anti-ATP5SL Antibody (CBMOAB-36577FYA)


Cat: CBMOAB-36577FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36577FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO36577FYA 100 µg
MO-AB-01205W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01205W 100 µg
MO-AB-10952W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10952W 100 µg
MO-AB-51570W Monoclonal Marmoset WB, ELISA MO51570W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO36577FYA
SpecificityThis antibody binds to Rhesus ATP5SL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP5SL Antibody is a mouse antibody against ATP5SL. It can be used for ATP5SL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP5SL
UniProt IDF6Z1P4
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MWDLVLGDRRINSLRLVAPMWNGTRGIHRLGGAVVPEGNQKKERKMLQFLNNHFYDVEALRGYLLQREMSKVHLKNRSFTWLEEQHGPYSAGAFFILKQGGAVKFRDKEWIRPDKYGHFSPEFWNFREVPVEAVDASDCEINYEGLDNLLLLKELQSLSLQRCPHVDDWCLSRLYPLADSLQELSLAGCPRVSERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCQVVGVDWAEGLKLGPEEQPQDTASPVPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry