AibGenesis™ Mouse Anti-ATP6V0C Antibody (CBMOAB-36595FYA)
Cat: CBMOAB-36595FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36595FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO36595FYA | 100 µg | ||
| MO-AB-01739H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01739C | 100 µg | ||
| MO-AB-07841R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07841R | 100 µg | ||
| MO-AB-14315Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14315Y | 100 µg | ||
| MO-AB-23580W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23580W | 100 µg | ||
| MO-AB-24250H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24250C | 100 µg | ||
| MO-AB-51587W | Monoclonal | Marmoset | WB, ELISA | MO51587W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO36595FYA |
| Specificity | This antibody binds to Rhesus ATP6V0C. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ATP6V0C Antibody is a mouse antibody against ATP6V0C. It can be used for ATP6V0C detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP6V0C |
| UniProt ID | F6U5K9 |
| Protein Refseq | The length of the protein is 155 amino acids long. The sequence is show below: MSESNNRPEYASFFAVMGASAAMVCSAPRAAYGTVKSRAGIAAMSVMRPELIMKSIVPVVMAGIIAIYGLVVAVLIASSLNDDISLYRSSLQLSAGLRVGPSGLAAGFAVGIVRNAGVRATAQQPRLFMGMILTLIFAEVLGLYGLIVALIHSTE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry