Mouse Anti-AVPR2 Antibody (CBMOAB-36667FYA)
Cat: CBMOAB-36667FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36667FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO36667FYA | 100 µg | ||
MO-AB-00150L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00150L | 100 µg | ||
MO-AB-06328Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06328Y | 100 µg | ||
MO-AB-07322Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07322Y | 100 µg | ||
MO-AB-07328W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07328W | 100 µg | ||
MO-AB-07908R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07908R | 100 µg | ||
MO-AB-14330Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14330Y | 100 µg | ||
MO-AB-20007W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20007W | 100 µg | ||
MO-AB-24046R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24046R | 100 µg | ||
MO-AB-29193W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29193W | 100 µg | ||
MO-AB-34449W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34449W | 100 µg | ||
MO-AB-41306W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41306W | 100 µg | ||
MO-AB-43831W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43831W | 100 µg | ||
MO-AB-51663W | Monoclonal | Marmoset | WB, ELISA | MO51663W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO36667FYA |
Specificity | This antibody binds to Rhesus AVPR2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the vasopressin receptor, type 2, also known as the V2 receptor, which belongs to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily, and couples to Gs thus stimulating adenylate cyclase. The subfamily that includes the V2 receptor, the V1a and V1b vasopressin receptors, the oxytocin receptor, and isotocin and mesotocin receptors in non-mammals, is well conserved, though several members signal via other G proteins. All bind similar cyclic nonapeptide hormones. The V2 receptor is expressed in the kidney tubule, predominantly in the distal convoluted tubule and collecting ducts, where its primary property is to respond to the pituitary hormone arginine vasopressin (AVP) by stimulating mechanisms that concentrate the urine and maintain water homeostasis in the organism. When the function of this gene is lost, the disease Nephrogenic Diabetes Insipidus (NDI) results. The V2 receptor is also expressed outside the kidney although its tissue localization is uncertain. When these 'extrarenal receptors' are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known - its absence does not appear to be detrimental in NDI patients. The gene expression has also been described in fetal lung tissue and lung cancer associated with alternative splicing. (From NCBI) |
Product Overview | Mouse Anti-Rhesus AVPR2 Antibody is a mouse antibody against AVPR2. It can be used for AVPR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Vasopressin V2 receptor; AVPR2 |
UniProt ID | F7ASW6 |
Protein Refseq | The length of the protein is 354 amino acids long. The sequence is show below: SLPSNSSQERPPDTRDPLLAQAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGGGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVGGGSGVTDCWASFVEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHTSLVPGPSERPGGRRRGRRTGNPSEGARVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDASS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry