Mouse Anti-AVPR2 Antibody (CBMOAB-36667FYA)


Cat: CBMOAB-36667FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36667FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO36667FYA 100 µg
MO-AB-00150L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00150L 100 µg
MO-AB-06328Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06328Y 100 µg
MO-AB-07322Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07322Y 100 µg
MO-AB-07328W Monoclonal Cat (Felis catus) WB, ELISA MO07328W 100 µg
MO-AB-07908R Monoclonal Cattle (Bos taurus) WB, ELISA MO07908R 100 µg
MO-AB-14330Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14330Y 100 µg
MO-AB-20007W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20007W 100 µg
MO-AB-24046R Monoclonal Pig (Sus scrofa) WB, ELISA MO24046R 100 µg
MO-AB-29193W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29193W 100 µg
MO-AB-34449W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34449W 100 µg
MO-AB-41306W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41306W 100 µg
MO-AB-43831W Monoclonal Horse (Equus caballus) WB, ELISA MO43831W 100 µg
MO-AB-51663W Monoclonal Marmoset WB, ELISA MO51663W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO36667FYA
SpecificityThis antibody binds to Rhesus AVPR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the vasopressin receptor, type 2, also known as the V2 receptor, which belongs to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily, and couples to Gs thus stimulating adenylate cyclase. The subfamily that includes the V2 receptor, the V1a and V1b vasopressin receptors, the oxytocin receptor, and isotocin and mesotocin receptors in non-mammals, is well conserved, though several members signal via other G proteins. All bind similar cyclic nonapeptide hormones. The V2 receptor is expressed in the kidney tubule, predominantly in the distal convoluted tubule and collecting ducts, where its primary property is to respond to the pituitary hormone arginine vasopressin (AVP) by stimulating mechanisms that concentrate the urine and maintain water homeostasis in the organism. When the function of this gene is lost, the disease Nephrogenic Diabetes Insipidus (NDI) results. The V2 receptor is also expressed outside the kidney although its tissue localization is uncertain. When these 'extrarenal receptors' are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known - its absence does not appear to be detrimental in NDI patients. The gene expression has also been described in fetal lung tissue and lung cancer associated with alternative splicing. (From NCBI)
Product OverviewMouse Anti-Rhesus AVPR2 Antibody is a mouse antibody against AVPR2. It can be used for AVPR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVasopressin V2 receptor; AVPR2
UniProt IDF7ASW6
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: SLPSNSSQERPPDTRDPLLAQAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGGGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVGGGSGVTDCWASFVEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHTSLVPGPSERPGGRRRGRRTGNPSEGARVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDASS.
For Research Use Only | Not For Clinical Use.
Online Inquiry