Mouse Anti-BCKDHB Antibody (CBMOAB-36850FYA)


Cat: CBMOAB-36850FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36850FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36850FYA 100 µg
CBMOAB-67546FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67546FYA 100 µg
MO-AB-01819H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01819C 100 µg
MO-AB-03418W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03418W 100 µg
MO-AB-08012R Monoclonal Cattle (Bos taurus) WB, ELISA MO08012R 100 µg
MO-AB-14395W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14395W 100 µg
MO-AB-51802W Monoclonal Marmoset WB, ELISA MO51802W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO36850FYA
SpecificityThis antibody binds to Rhesus BCKDHB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the E1 beta subunit of branched-chain keto acid dehydrogenase, which is a multienzyme complex associated with the inner membrane of mitochondria. This enzyme complex functions in the catabolism of branched-chain amino acids. Mutations in this gene have been associated with maple syrup urine disease (MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physical retardation and feeding problems. Alternative splicing at this locus results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus BCKDHB Antibody is a mouse antibody against BCKDHB. It can be used for BCKDHB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCKDHB
UniProt IDF6QJG4
Protein RefseqThe length of the protein is 391 amino acids long.
The sequence is show below: MAVVAAAAGWLLRLRAAGAEGHWRRFRGVGLARGFLHPSATVEDAAQRRQVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQVIHEILKYCHYPSTHPYLHSRNIFNNWLFKIKSSLLGYIFTKIVLKNLFLQVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEQVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY.
For Research Use Only | Not For Clinical Use.
Online Inquiry