Mouse Anti-BEAN1 Antibody (CBMOAB-36910FYA)


Cat: CBMOAB-36910FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36910FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO36910FYA 100 µg
MO-AB-23624W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23624W 100 µg
MO-AB-24359H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24359C 100 µg
MO-AB-51842W Monoclonal Marmoset WB, ELISA MO51842W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO36910FYA
SpecificityThis antibody binds to Rhesus BEAN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of several proteins that interact with NEDD4, a member of a family of ubiquitin-protein ligases. These proteins have PY motifs in common that bind to the WW domains of NEDD4. NEDD4 is developmentally regulated, and is highly expressed in embryonic tissues. Mutations in this gene (i.e., intronic insertions of>100 copies of pentanucleotide repeats including a (TGGAA)n sequence) are associated with spinocerebellar ataxia type 31. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus BEAN1 Antibody is a mouse antibody against BEAN1. It can be used for BEAN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBEAN1
UniProt IDF7HRM9
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: VLDGHTYSRSSHRMRYACSSSEDWPPPLDISSDGDVDAMVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSNSGSSHSPGRHQQEQRTPAQSGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPGPGSRGSQDSPTPTRALASGPERIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry