AibGenesis™ Mouse Anti-BEND7 Antibody (MO-AB-01287W)


Cat: MO-AB-01287W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01287W Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO01287W 100 µg
MO-AB-24120R Monoclonal Pig (Sus scrofa) WB, ELISA MO24120R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO01287W
SpecificityThis antibody binds to Rhesus BEND7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBEND7 (BEN Domain Containing 7) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus BEND7 Antibody is a mouse antibody against BEND7. It can be used for BEND7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBEN domain-containing protein 7 isoform 1; BEND7
UniProt IDH9FKB0
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: HTSPEESRVLGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTAHHVDKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry