Mouse Anti-Rhesus BLNK Antibody (CBMOAB-37001FYA)


Cat: CBMOAB-37001FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO37001FYA
SpecificityThis antibody binds to Rhesus BLNK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus BLNK Antibody is a mouse antibody against BLNK. It can be used for BLNK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBLNK
UniProt IDF7EYN2
Protein RefseqThe length of the protein is 442 amino acids long.
The sequence is show below: RQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYVDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPRVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPERAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPSPAAPSPLPRAGKKPMTPLKTTPVASQQNTSSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQLHQKPIPLPRFTEGGNPTVDGPVPSFSSNSTISEQEAGVLCKPWYAGDCDRKSAEEALHRSNKGDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIKNHQHSPLVLIDSQNNTKDSTRLKYAVKVS.
See other products for " blnk "
CBMOAB-67719FYAMouse Anti-Zebrafish blnk Antibody (CBMOAB-67719FYA)
MO-AB-01311WMouse Anti-Rhesus BLNK Antibody (MO-AB-01311W)
MO-AB-08103RMouse Anti-Cattle BLNK Antibody (MO-AB-08103R)
MO-AB-01874HMouse Anti-Frog blnk Antibody (MO-AB-01874H)
MO-AB-51882WMouse Anti-Marmoset BLNK Antibody (MO-AB-51882W)
For Research Use Only | Not For Clinical Use.
Online Inquiry